PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676763598
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family GATA
Protein Properties Length: 293aa    MW: 32874.9 Da    PI: 9.5111
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676763598genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.42.7e-20212246135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  676763598 212 CTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRL 246
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.3E-20206260IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.28E-15210269No hitNo description
PROSITE profilePS5011412.123210242IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.8E-15210243IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.62E-17211260No hitNo description
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
PfamPF003205.9E-18212246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MNNGSWLPEE DFKGLTDNFF DDLINQIDFP LEDIETTNEE GDWDAEFKKL IPPPLDVLTS  60
LSSEFARGST CKGQRVGVQN KPVPILKQSQ VSSNVESSLP DVKVSKLFQS SSPVSVLENA  120
ANGSVSFQNP NRAQRLAFPV KGIRSKRKRP TILRFRSLHS FASEMIEKKV APGDDSDSEE  180
TYPFSENPAK KKRKKNNSSP EPFNADGTIR KCTHCETTKT PQWREGPSGP KTLCNACGVR  240
FRSGRLLPEY RPASSPTFIP TVHSNSHRKI IEMRRKDEDQ FETGMTRAVR SRG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190194KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630850.11e-160PREDICTED: putative GATA transcription factor 13
RefseqXP_013692534.11e-160PREDICTED: putative GATA transcription factor 13
SwissprotQ6DBP81e-112GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A0D3BU681e-160A0A0D3BU68_BRAOL; Uncharacterized protein
STRINGBra011956.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-113GATA transcription factor 11